Brand: | Abnova |
Reference: | H00002919-A01 |
Product name: | CXCL1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CXCL1. |
Gene id: | 2919 |
Gene name: | CXCL1 |
Gene alias: | FSP|GRO1|GROa|MGSA|MGSA-a|NAP-3|SCYB1 |
Gene description: | chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) |
Genbank accession: | BC011976 |
Immunogen: | CXCL1 (AAH11976, 36 a.a. ~ 107 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
Protein accession: | AAH11976 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.03 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |