GRM7 monoclonal antibody (M01), clone 1H5 View larger

GRM7 monoclonal antibody (M01), clone 1H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRM7 monoclonal antibody (M01), clone 1H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GRM7 monoclonal antibody (M01), clone 1H5

Brand: Abnova
Reference: H00002917-M01
Product name: GRM7 monoclonal antibody (M01), clone 1H5
Product description: Mouse monoclonal antibody raised against a partial recombinant GRM7.
Clone: 1H5
Isotype: IgG2a Kappa
Gene id: 2917
Gene name: GRM7
Gene alias: FLJ40498|GLUR7|GPRC1G|MGLUR7|mGlu7
Gene description: glutamate receptor, metabotropic 7
Genbank accession: NM_000844
Immunogen: GRM7 (NP_000835, 431 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPA
Protein accession: NP_000835
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002917-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002917-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged GRM7 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GRM7 monoclonal antibody (M01), clone 1H5 now

Add to cart