GRM5 monoclonal antibody (M07), clone 3E7 View larger

GRM5 monoclonal antibody (M07), clone 3E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRM5 monoclonal antibody (M07), clone 3E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GRM5 monoclonal antibody (M07), clone 3E7

Brand: Abnova
Reference: H00002915-M07
Product name: GRM5 monoclonal antibody (M07), clone 3E7
Product description: Mouse monoclonal antibody raised against a partial recombinant GRM5.
Clone: 3E7
Isotype: IgG2b Kappa
Gene id: 2915
Gene name: GRM5
Gene alias: GPRC1E|MGLUR5|mGlu5
Gene description: glutamate receptor, metabotropic 5
Genbank accession: NM_000842
Immunogen: GRM5 (NP_000833, 419 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CPGYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKG
Protein accession: NP_000833
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002915-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002915-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GRM5 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GRM5 monoclonal antibody (M07), clone 3E7 now

Add to cart