Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GRLF1 monoclonal antibody (M01), clone 4D4-F8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about GRLF1 monoclonal antibody (M01), clone 4D4-F8
| Brand: | Abnova |
| Reference: | H00002909-M01 |
| Product name: | GRLF1 monoclonal antibody (M01), clone 4D4-F8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GRLF1. |
| Clone: | 4D4-F8 |
| Isotype: | IgG2a kappa |
| Gene id: | 2909 |
| Gene name: | GRLF1 |
| Gene alias: | GRF-1|KIAA1722|MGC10745|P190-A|P190A|p190RhoGAP |
| Gene description: | glucocorticoid receptor DNA binding factor 1 |
| Genbank accession: | BC003514 |
| Immunogen: | GRLF1 (AAH03514, 1 a.a. ~ 36 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR |
| Protein accession: | AAH03514 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GRLF1 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |