GRIN2C purified MaxPab mouse polyclonal antibody (B01P) View larger

GRIN2C purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRIN2C purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about GRIN2C purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00002905-B01P
Product name: GRIN2C purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human GRIN2C protein.
Gene id: 2905
Gene name: GRIN2C
Gene alias: NMDAR2C|NR2C
Gene description: glutamate receptor, ionotropic, N-methyl D-aspartate 2C
Genbank accession: BC059384
Immunogen: GRIN2C (AAH59384.1, 1 a.a. ~ 171 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPLEIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPILSISGGSAVVLTPKVHVQTHVPSCLRPGTRLGSGVLWFWEAGIRRDGQGGGG
Protein accession: AAH59384.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002905-B01P-13-15-1.jpg
Application image note: Western Blot analysis of GRIN2C expression in transfected 293T cell line (H00002905-T02) by GRIN2C MaxPab polyclonal antibody.

Lane 1: GRIN2C transfected lysate(18.81 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GRIN2C purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart