Brand: | Abnova |
Reference: | H00002896-M02 |
Product name: | GRN monoclonal antibody (M02), clone 1A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GRN. |
Clone: | 1A8 |
Isotype: | IgG2a Kappa |
Gene id: | 2896 |
Gene name: | GRN |
Gene alias: | GEP|GP88|PCDGF|PEPI|PGRN |
Gene description: | granulin |
Genbank accession: | NM_002087 |
Immunogen: | GRN (NP_002078, 494 a.a. ~ 593 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SCEKEVVSAQPATFLARSPHVAVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL |
Protein accession: | NP_002078 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GRN is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |