GRID2 monoclonal antibody (M01), clone 1A1 View larger

GRID2 monoclonal antibody (M01), clone 1A1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRID2 monoclonal antibody (M01), clone 1A1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GRID2 monoclonal antibody (M01), clone 1A1

Brand: Abnova
Reference: H00002895-M01
Product name: GRID2 monoclonal antibody (M01), clone 1A1
Product description: Mouse monoclonal antibody raised against a partial recombinant GRID2.
Clone: 1A1
Isotype: IgG1 Kappa
Gene id: 2895
Gene name: GRID2
Gene alias: MGC117022|MGC117023|MGC117024
Gene description: glutamate receptor, ionotropic, delta 2
Genbank accession: NM_001510
Immunogen: GRID2 (NP_001501, 908 a.a. ~ 1007 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
Protein accession: NP_001501
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002895-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002895-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged GRID2 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GRID2 monoclonal antibody (M01), clone 1A1 now

Add to cart