GRK4 polyclonal antibody (A01) View larger

GRK4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRK4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about GRK4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00002868-A01
Product name: GRK4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GRK4.
Gene id: 2868
Gene name: GRK4
Gene alias: GPRK2L|GPRK4|GRK4a|IT11
Gene description: G protein-coupled receptor kinase 4
Genbank accession: NM_182982
Immunogen: GRK4 (NP_892027, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDTKPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFNDKLAAPLPEIPPDVVTECRLGLKEENPSKKAFEE
Protein accession: NP_892027
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002868-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002868-A01-1-2-1.jpg
Application image note: GRK4 polyclonal antibody (A01), Lot # 060516JCS1 Western Blot analysis of GRK4 expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GRK4 polyclonal antibody (A01) now

Add to cart