MCHR1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

MCHR1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MCHR1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Tr

More info about MCHR1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002847-D01P
Product name: MCHR1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human MCHR1 protein.
Gene id: 2847
Gene name: MCHR1
Gene alias: GPR24|MCH1R|MGC32129|SLC1
Gene description: melanin-concentrating hormone receptor 1
Genbank accession: BC021146
Immunogen: MCHR1 (AAH21146.1, 1 a.a. ~ 422 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
Protein accession: AAH21146.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00002847-D01P-13-15-1.jpg
Application image note: Western Blot analysis of MCHR1 expression in transfected 293T cell line (H00002847-T01) by MCHR1 MaxPab polyclonal antibody.

Lane 1: MCHR1 transfected lysate(46.00 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MCHR1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart