Brand: | Abnova |
Reference: | H00002817-A01 |
Product name: | GPC1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GPC1. |
Gene id: | 2817 |
Gene name: | GPC1 |
Gene alias: | FLJ38078|glypican |
Gene description: | glypican 1 |
Genbank accession: | NM_002081 |
Immunogen: | GPC1 (NP_002072, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | DPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFG |
Protein accession: | NP_002072 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Internalization and Trafficking of Cell Surface Proteoglycans and Proteoglycan-Binding Ligands.Payne CK, Jones SA, Chen C, Zhuang X. Traffic. 2007 Apr;8(4):389-401. |