Brand: | Abnova |
Reference: | H00002811-A01 |
Product name: | GP1BA polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GP1BA. |
Gene id: | 2811 |
Gene name: | GP1BA |
Gene alias: | BSS|CD42B|CD42b-alpha|GP1B|MGC34595 |
Gene description: | glycoprotein Ib (platelet), alpha polypeptide |
Genbank accession: | BC027955 |
Immunogen: | GP1BA (AAH27955, 19 a.a. ~ 128 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVPFNRL |
Protein accession: | AAH27955 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |