GNGT2 MaxPab mouse polyclonal antibody (B01) View larger

GNGT2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GNGT2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about GNGT2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00002793-B01
Product name: GNGT2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human GNGT2 protein.
Gene id: 2793
Gene name: GNGT2
Gene alias: G-GAMMA-8|G-GAMMA-C|GNG8|GNG9|GNGT8
Gene description: guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2
Genbank accession: BC008663.1
Immunogen: GNGT2 (AAH08663.1, 1 a.a. ~ 69 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
Protein accession: AAH08663.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002793-B01-13-15-1.jpg
Application image note: Western Blot analysis of GNGT2 expression in transfected 293T cell line (H00002793-T02) by GNGT2 MaxPab polyclonal antibody.

Lane 1: GNGT2 transfected lysate(7.70 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GNGT2 MaxPab mouse polyclonal antibody (B01) now

Add to cart