GHR monoclonal antibody (M01), clone 3A12 View larger

GHR monoclonal antibody (M01), clone 3A12

H00002690-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GHR monoclonal antibody (M01), clone 3A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,PLA-Ce

More info about GHR monoclonal antibody (M01), clone 3A12

Brand: Abnova
Reference: H00002690-M01
Product name: GHR monoclonal antibody (M01), clone 3A12
Product description: Mouse monoclonal antibody raised against a partial recombinant GHR.
Clone: 3A12
Isotype: IgG2a Kappa
Gene id: 2690
Gene name: GHR
Gene alias: GHBP
Gene description: growth hormone receptor
Genbank accession: NM_000163
Immunogen: GHR (NP_000154, 19 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSF
Protein accession: NP_000154
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002690-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002690-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged GHR is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy GHR monoclonal antibody (M01), clone 3A12 now

Add to cart