GH2 monoclonal antibody (M01), clone 1E11 View larger

GH2 monoclonal antibody (M01), clone 1E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GH2 monoclonal antibody (M01), clone 1E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GH2 monoclonal antibody (M01), clone 1E11

Brand: Abnova
Reference: H00002689-M01
Product name: GH2 monoclonal antibody (M01), clone 1E11
Product description: Mouse monoclonal antibody raised against a full length recombinant GH2.
Clone: 1E11
Isotype: IgG1 Kappa
Gene id: 2689
Gene name: GH2
Gene alias: GH-V|GHL|GHV|hGH-V
Gene description: growth hormone 2
Genbank accession: BC020760
Immunogen: GH2 (AAH20760.1, 27 a.a. ~ 217 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Protein accession: AAH20760.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002689-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.75 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002689-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GH2 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GH2 monoclonal antibody (M01), clone 1E11 now

Add to cart