Brand: | Abnova |
Reference: | H00002688-M02 |
Product name: | GH1 monoclonal antibody (M02), clone 8G6 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant GH1. |
Clone: | 8G6 |
Isotype: | IgG2a Kappa |
Gene id: | 2688 |
Gene name: | GH1 |
Gene alias: | GH|GH-N|GHN|hGH-N |
Gene description: | growth hormone 1 |
Genbank accession: | BC075012.2 |
Immunogen: | GH1 (AAH75012.1, 1 a.a. ~ 217 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF |
Protein accession: | AAH75012.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (51.2 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GH1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |