GFAP monoclonal antibody (M02), clone 2E9 View larger

GFAP monoclonal antibody (M02), clone 2E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GFAP monoclonal antibody (M02), clone 2E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about GFAP monoclonal antibody (M02), clone 2E9

Brand: Abnova
Reference: H00002670-M02
Product name: GFAP monoclonal antibody (M02), clone 2E9
Product description: Mouse monoclonal antibody raised against a partial recombinant GFAP.
Clone: 2E9
Isotype: IgG2b Kappa
Gene id: 2670
Gene name: GFAP
Gene alias: FLJ45472
Gene description: glial fibrillary acidic protein
Genbank accession: BC041765
Immunogen: GFAP (AAH41765, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPD
Protein accession: AAH41765
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002670-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002670-M02-13-15-1.jpg
Application image note: Western Blot analysis of GFAP expression in transfected 293T cell line by GFAP monoclonal antibody (M02), clone 2E9.

Lane 1: GFAP transfected lysate (Predicted MW: 49.9 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GFAP monoclonal antibody (M02), clone 2E9 now

Add to cart