GDF8 monoclonal antibody (M07), clone 3E7 View larger

GDF8 monoclonal antibody (M07), clone 3E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GDF8 monoclonal antibody (M07), clone 3E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about GDF8 monoclonal antibody (M07), clone 3E7

Brand: Abnova
Reference: H00002660-M07
Product name: GDF8 monoclonal antibody (M07), clone 3E7
Product description: Mouse monoclonal antibody raised against a full length recombinant GDF8.
Clone: 3E7
Isotype: IgG2a Kappa
Gene id: 2660
Gene name: MSTN
Gene alias: GDF8
Gene description: myostatin
Genbank accession: NM_005259
Immunogen: GDF8 (NP_005250, 241 a.a. ~ 310 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS
Protein accession: NP_005250
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002660-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.48 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002660-M07-1-21-1.jpg
Application image note: GDF8 monoclonal antibody (M07), clone 3E7 Western Blot analysis of GDF8 expression in LNCaP ( Cat # L004V1 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GDF8 monoclonal antibody (M07), clone 3E7 now

Add to cart