Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00002660-M06 |
Product name: | GDF8 monoclonal antibody (M06), clone 2D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GDF8. |
Clone: | 2D8 |
Isotype: | IgG2a Kappa |
Gene id: | 2660 |
Gene name: | MSTN |
Gene alias: | GDF8 |
Gene description: | myostatin |
Genbank accession: | NM_005259 |
Immunogen: | GDF8 (NP_005250, 241 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS |
Protein accession: | NP_005250 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.48 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of GDF8 expression in transfected 293T cell line by GDF8 monoclonal antibody (M06), clone 2D8. Lane 1: GDF8 transfected lysate(42.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |