GDF8 monoclonal antibody (M06), clone 2D8 View larger

GDF8 monoclonal antibody (M06), clone 2D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GDF8 monoclonal antibody (M06), clone 2D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about GDF8 monoclonal antibody (M06), clone 2D8

Brand: Abnova
Reference: H00002660-M06
Product name: GDF8 monoclonal antibody (M06), clone 2D8
Product description: Mouse monoclonal antibody raised against a partial recombinant GDF8.
Clone: 2D8
Isotype: IgG2a Kappa
Gene id: 2660
Gene name: MSTN
Gene alias: GDF8
Gene description: myostatin
Genbank accession: NM_005259
Immunogen: GDF8 (NP_005250, 241 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS
Protein accession: NP_005250
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002660-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.48 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002660-M06-13-15-1.jpg
Application image note: Western Blot analysis of GDF8 expression in transfected 293T cell line by GDF8 monoclonal antibody (M06), clone 2D8.

Lane 1: GDF8 transfected lysate(42.8 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GDF8 monoclonal antibody (M06), clone 2D8 now

Add to cart