Brand: | Abnova |
Reference: | H00002658-A01 |
Product name: | GDF2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GDF2. |
Gene id: | 2658 |
Gene name: | GDF2 |
Gene alias: | BMP-9|BMP9 |
Gene description: | growth differentiation factor 2 |
Genbank accession: | NM_016204 |
Immunogen: | GDF2 (NP_057288, 320 a.a. ~ 419 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYE |
Protein accession: | NP_057288 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GDF2 polyclonal antibody (A01), Lot # 051012JC01. Western Blot analysis of GDF2 expression in Daoy. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |