Brand: | Abnova |
Reference: | H00002651-B01P |
Product name: | GCNT2 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human GCNT2 protein. |
Gene id: | 2651 |
Gene name: | GCNT2 |
Gene alias: | CCAT|GCNT2C|GCNT5|IGNT|II|MGC163396|NACGT1|NAGCT1|ULG3|bA360O19.2|bA421M1.1 |
Gene description: | glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) |
Genbank accession: | NM_145655.3 |
Immunogen: | GCNT2 (NP_663630.2, 1 a.a. ~ 402 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYITSPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNAFIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF |
Protein accession: | NP_663630.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GCNT2 MaxPab polyclonal antibody. Western Blot analysis of GCNT2 expression in human placenta. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |