KAT2A (Human) Recombinant Protein (Q02) View larger

KAT2A (Human) Recombinant Protein (Q02)

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KAT2A (Human) Recombinant Protein (Q02)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about KAT2A (Human) Recombinant Protein (Q02)

Brand: Abnova
Reference: H00002648-Q02
Product name: KAT2A (Human) Recombinant Protein (Q02)
Product description: Human KAT2A partial ORF (NP_066564.2, 733 a.a. - 818 a.a.) recombinant protein with GST tag at N-terminal.
Gene id: 2648
Gene name: KAT2A
Gene alias: GCN5|GCN5L2|MGC102791|PCAF-b|hGCN5
Gene description: K(lysine) acetyltransferase 2A
Genbank accession: NM_021078.2
Immunogen sequence/protein sequence: LYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCA
Protein accession: NP_066564.2
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00002648-Q02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KAT2A (Human) Recombinant Protein (Q02) now

Add to cart