Brand: | Abnova |
Reference: | H00002648-M03 |
Product name: | GCN5L2 monoclonal antibody (M03), clone 4F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GCN5L2. |
Clone: | 4F9 |
Isotype: | IgG2a Kappa |
Gene id: | 2648 |
Gene name: | KAT2A |
Gene alias: | GCN5|GCN5L2|MGC102791|PCAF-b|hGCN5 |
Gene description: | K(lysine) acetyltransferase 2A |
Genbank accession: | BC032743 |
Immunogen: | GCN5L2 (AAH32743, 738 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK |
Protein accession: | AAH32743 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GCN5L2 monoclonal antibody (M03), clone 4F9 Western Blot analysis of GCN5L2 expression in MCF-7 ( Cat # L046V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |