Brand: | Abnova |
Reference: | H00002643-M02 |
Product name: | GCH1 monoclonal antibody (M02), clone 2C4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant GCH1. |
Clone: | 2C4 |
Isotype: | IgG1 Kappa |
Gene id: | 2643 |
Gene name: | GCH1 |
Gene alias: | DYT14|DYT5|GCH|GTP-CH-1|GTPCH1 |
Gene description: | GTP cyclohydrolase 1 |
Genbank accession: | BC025415 |
Immunogen: | GCH1 (AAH25415.1, 1 a.a. ~ 250 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS |
Protein accession: | AAH25415.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GCH1 is approximately 0.1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |