GCH1 purified MaxPab mouse polyclonal antibody (B01P) View larger

GCH1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCH1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about GCH1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00002643-B01P
Product name: GCH1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human GCH1 protein.
Gene id: 2643
Gene name: GCH1
Gene alias: DYT14|DYT5|GCH|GTP-CH-1|GTPCH1
Gene description: GTP cyclohydrolase 1
Genbank accession: NM_000161.2
Immunogen: GCH1 (NP_000152.1, 1 a.a. ~ 250 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
Protein accession: NP_000152.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002643-B01P-13-15-1.jpg
Application image note: Western Blot analysis of GCH1 expression in transfected 293T cell line (H00002643-T01) by GCH1 MaxPab polyclonal antibody.

Lane 1: GCH1 transfected lysate(27.5 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GCH1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart