Brand: | Abnova |
Reference: | H00002641-A01 |
Product name: | GCG polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant GCG. |
Gene id: | 2641 |
Gene name: | GCG |
Gene alias: | GLP1|GLP2|GRPP |
Gene description: | glucagon |
Genbank accession: | BC005278 |
Immunogen: | GCG (AAH05278, 1 a.a. ~ 180 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK |
Protein accession: | AAH05278 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (45.91 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |