GBX2 (Human) Recombinant Protein (Q02) View larger

GBX2 (Human) Recombinant Protein (Q02)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GBX2 (Human) Recombinant Protein (Q02)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about GBX2 (Human) Recombinant Protein (Q02)

Brand: Abnova
Reference: H00002637-Q02
Product name: GBX2 (Human) Recombinant Protein (Q02)
Product description: Human GBX2 partial ORF (NP_001476.2, 141 a.a. - 230 a.a.) recombinant protein with GST tag at N-terminal.
Gene id: 2637
Gene name: GBX2
Gene alias: -
Gene description: gastrulation brain homeobox 2
Genbank accession: NM_001485.2
Immunogen sequence/protein sequence: AEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEE
Protein accession: NP_001476.2
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00002637-Q02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GBX2 (Human) Recombinant Protein (Q02) now

Add to cart