GATA6 polyclonal antibody (A01) View larger

GATA6 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GATA6 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about GATA6 polyclonal antibody (A01)

Brand: Abnova
Reference: H00002627-A01
Product name: GATA6 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GATA6.
Gene id: 2627
Gene name: GATA6
Gene alias: -
Gene description: GATA binding protein 6
Genbank accession: NM_005257
Immunogen: GATA6 (NP_005248, 496 a.a. ~ 595 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA
Protein accession: NP_005248
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002627-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: GATA4 Reduction Enhances 3',5'-Cyclic Adenosine 5'-Monophosphate-Stimulated Steroidogenic Acute Regulatory Protein Messenger Ribonucleic Acid and Progesterone Production in Luteinized Porcine Granulosa Cells.Hui YY, Lavoie HA.
Endocrinology. 2008 Nov;149(11):5557-67. Epub 2008 Jul 24.

Reviews

Buy GATA6 polyclonal antibody (A01) now

Add to cart