Brand: | Abnova |
Reference: | H00002625-M17A |
Product name: | GATA3 monoclonal antibody (M17A), clone 4D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GATA3. |
Clone: | 4D10 |
Isotype: | IgG2a Kappa |
Gene id: | 2625 |
Gene name: | GATA3 |
Gene alias: | HDR|MGC2346|MGC5199|MGC5445 |
Gene description: | GATA binding protein 3 |
Genbank accession: | NM_001002295 |
Immunogen: | GATA3 (NP_001002295.1, 103 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSH |
Protein accession: | NP_001002295.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |