Brand: | Abnova |
Reference: | H00002624-M03A |
Product name: | GATA2 monoclonal antibody (M03A), clone 2F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GATA2. |
Clone: | 2F12 |
Isotype: | IgG |
Gene id: | 2624 |
Gene name: | GATA2 |
Gene alias: | MGC2306|NFE1B |
Gene description: | GATA binding protein 2 |
Genbank accession: | BC018988 |
Immunogen: | GATA2 (AAH18988, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGK |
Protein accession: | AAH18988 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GATA2 monoclonal antibody (M03A), clone 2F12 Western Blot analysis of GATA2 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |