GATA2 monoclonal antibody (M03), clone 2F12 View larger

GATA2 monoclonal antibody (M03), clone 2F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GATA2 monoclonal antibody (M03), clone 2F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about GATA2 monoclonal antibody (M03), clone 2F12

Brand: Abnova
Reference: H00002624-M03
Product name: GATA2 monoclonal antibody (M03), clone 2F12
Product description: Mouse monoclonal antibody raised against a partial recombinant GATA2.
Clone: 2F12
Isotype: IgG
Gene id: 2624
Gene name: GATA2
Gene alias: MGC2306|NFE1B
Gene description: GATA binding protein 2
Genbank accession: BC018988
Immunogen: GATA2 (AAH18988, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGK
Protein accession: AAH18988
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002624-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.96 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002624-M03-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to GATA2 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GATA2 monoclonal antibody (M03), clone 2F12 now

Add to cart