GATA2 monoclonal antibody (M01), clone 2D11 View larger

GATA2 monoclonal antibody (M01), clone 2D11

H00002624-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GATA2 monoclonal antibody (M01), clone 2D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about GATA2 monoclonal antibody (M01), clone 2D11

Brand: Abnova
Reference: H00002624-M01
Product name: GATA2 monoclonal antibody (M01), clone 2D11
Product description: Mouse monoclonal antibody raised against a partial recombinant GATA2.
Clone: 2D11
Isotype: IgG2a Kappa
Gene id: 2624
Gene name: GATA2
Gene alias: MGC2306|NFE1B
Gene description: GATA binding protein 2
Genbank accession: BC018988
Immunogen: GATA2 (AAH18988, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGK
Protein accession: AAH18988
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002624-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.96 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002624-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to GATA2 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice
Publications: Single-cell epigenomic variability reveals functional cancer heterogeneity.Litzenburger UM, Buenrostro JD, Wu B, Shen Y, Sheffield NC, Kathiria A, Greenleaf WJ, Chang HY.
Genome Biol. 2017 Jan 24;18(1):15.

Reviews

Buy GATA2 monoclonal antibody (M01), clone 2D11 now

Add to cart