Brand: | Abnova |
Reference: | H00002623-M06 |
Product name: | GATA1 monoclonal antibody (M06), clone 3G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GATA1. |
Clone: | 3G6 |
Isotype: | IgG2a Kappa |
Gene id: | 2623 |
Gene name: | GATA1 |
Gene alias: | ERYF1|GF-1|GF1|NFE1 |
Gene description: | GATA binding protein 1 (globin transcription factor 1) |
Genbank accession: | NM_002049 |
Immunogen: | GATA1 (ENSP00000365858, 123 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC |
Protein accession: | ENSP00000365858 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GATA1 monoclonal antibody (M06), clone 3G6. Western Blot analysis of GATA1 expression in Jurkat(Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |