Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GAPDH monoclonal antibody (M03), clone 1G5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,IP |
More info about GAPDH monoclonal antibody (M03), clone 1G5
| Brand: | Abnova |
| Reference: | H00002597-M03 |
| Product name: | GAPDH monoclonal antibody (M03), clone 1G5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GAPDH. |
| Clone: | 1G5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2597 |
| Gene name: | GAPDH |
| Gene alias: | G3PD|GAPD|MGC88685 |
| Gene description: | glyceraldehyde-3-phosphate dehydrogenase |
| Genbank accession: | NM_002046 |
| Immunogen: | GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE |
| Protein accession: | NP_002037 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GAPDH monoclonal antibody (M03), clone 1G5. Western Blot analysis of GAPDH expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | BLMP-1/Blimp-1 regulates the spatiotemporal cell migration pattern in C. elegans.Huang TF, Cho CY, Cheng YT, Huang JW, Wu YZ, Yeh AY, Nishiwaki K, Chang SC, Wu YC PLoS Genet. 2014 Jun 26;10(6):e1004428. doi: 10.1371/journal.pgen.1004428. eCollection 2014 Jun. |