GALNT1 monoclonal antibody (M10), clone 3C10 View larger

GALNT1 monoclonal antibody (M10), clone 3C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GALNT1 monoclonal antibody (M10), clone 3C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about GALNT1 monoclonal antibody (M10), clone 3C10

Brand: Abnova
Reference: H00002589-M10
Product name: GALNT1 monoclonal antibody (M10), clone 3C10
Product description: Mouse monoclonal antibody raised against a partial recombinant GALNT1.
Clone: 3C10
Isotype: IgG2a Kappa
Gene id: 2589
Gene name: GALNT1
Gene alias: GALNAC-T1
Gene description: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1)
Genbank accession: NM_020474
Immunogen: GALNT1 (NP_065207, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIV
Protein accession: NP_065207
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002589-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.76 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002589-M10-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GALNT1 is 0.3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GALNT1 monoclonal antibody (M10), clone 3C10 now

Add to cart