Brand: | Abnova |
Reference: | H00002582-D01 |
Product name: | GALE MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human GALE protein. |
Gene id: | 2582 |
Gene name: | GALE |
Gene alias: | FLJ95174|FLJ97302|SDR1E1 |
Gene description: | UDP-galactose-4-epimerase |
Genbank accession: | NM_000403.3 |
Immunogen: | GALE (NP_000394.2, 1 a.a. ~ 348 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA |
Protein accession: | NP_000394.2 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00002582-D01-31-15-1.jpg](http://www.abnova.com/application_image/H00002582-D01-31-15-1.jpg) |
Application image note: | Immunoprecipitation of GALE transfected lysate using anti-GALE MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GALE MaxPab rabbit polyclonal antibody (D01) (H00002582-D01). |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |