GALE purified MaxPab mouse polyclonal antibody (B01P) View larger

GALE purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GALE purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about GALE purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00002582-B01P
Product name: GALE purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human GALE protein.
Gene id: 2582
Gene name: GALE
Gene alias: FLJ95174|FLJ97302|SDR1E1
Gene description: UDP-galactose-4-epimerase
Genbank accession: NM_000403.3
Immunogen: GALE (NP_000394.2, 1 a.a. ~ 348 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Protein accession: NP_000394.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002582-B01P-13-15-1.jpg
Application image note: Western Blot analysis of GALE expression in transfected 293T cell line (H00002582-T01) by GALE MaxPab polyclonal antibody.

Lane 1: GALE transfected lysate(38.28 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GALE purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart