Brand: | Abnova |
Reference: | H00002582-A01 |
Product name: | GALE polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant GALE. |
Gene id: | 2582 |
Gene name: | GALE |
Gene alias: | FLJ95174|FLJ97302|SDR1E1 |
Gene description: | UDP-galactose-4-epimerase |
Genbank accession: | BC001273 |
Immunogen: | GALE (AAH01273, 1 a.a. ~ 348 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA |
Protein accession: | AAH01273 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (64.39 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |