Brand: | Abnova |
Reference: | H00002553-A01 |
Product name: | GABPB2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GABPB2. |
Gene id: | 2553 |
Gene name: | GABPB1 |
Gene alias: | BABPB2|E4TF1|E4TF1-47|E4TF1-53|E4TF1B|GABPB|GABPB2|NRF2B1|NRF2B2 |
Gene description: | GA binding protein transcription factor, beta subunit 1 |
Genbank accession: | NM_002041 |
Immunogen: | GABPB2 (NP_002032, 274 a.a. ~ 360 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | TIVTDGIQLGNLHSIPTSGIGQPIIVTMPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEVRSLLPGVLCRSHPK |
Protein accession: | NP_002032 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00002553-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00002553-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (35.68 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00002553-A01-1-15-1.jpg](http://www.abnova.com/application_image/H00002553-A01-1-15-1.jpg) |
Application image note: | GABPB2 polyclonal antibody (A01), Lot # 060703JCS1 Western Blot analysis of GABPB2 expression in 293 ( Cat # L026V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | A Hepatic GAbp-AMPK Axis Links Inflammatory Signaling to Systemic Vascular Damage.Niopek K, Ustunel BE, Seitz S, Sakurai M, Zota A, Mattijssen F, Wang X, Sijmonsma T, Feuchter Y, Gail AM, Leuchs B, Niopek D, Staufer O, Brune M, Sticht C, Gretz N, Muller-Decker K, Hammes HP, Nawroth P, Fleming T, Conkright MD, Bluher M, Zeigerer A, Herzig S, Berriel Diaz M. Cell Rep. 2017 Aug 8;20(6):1422-1434. doi: 10.1016/j.celrep.2017.07.023. |