Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GABBR1 monoclonal antibody (M01), clone 2D7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about GABBR1 monoclonal antibody (M01), clone 2D7
| Brand: | Abnova |
| Reference: | H00002550-M01 |
| Product name: | GABBR1 monoclonal antibody (M01), clone 2D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GABBR1. |
| Clone: | 2D7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2550 |
| Gene name: | GABBR1 |
| Gene alias: | FLJ92613|GABAB(1e)|GABABR1|GABBR1-3|GPRC3A|dJ271M21.1.1|dJ271M21.1.2|hGB1a |
| Gene description: | gamma-aminobutyric acid (GABA) B receptor, 1 |
| Genbank accession: | BC050532 |
| Immunogen: | GABBR1 (AAH50532, 52 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG |
| Protein accession: | AAH50532 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to GABBR1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Genome-wide association study reveals multiple nasopharyngeal carcinoma-associated loci within the HLA region at chromosome 6p21.3.Tse KP, Su WH, Chang KP, Tsang NM, Yu CJ, Tang P, See LC, Hsueh C, Yang ML, Hao SP, Li HY, Wang MH, Liao LP, Chen LC, Lin SR, Jorgensen TJ, Chang YS, Shugart YY. Am J Hum Genet. 2009 Aug;85(2):194-203. Epub 2009 Aug 6. |