Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GAA monoclonal antibody (M01), clone 3C6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about GAA monoclonal antibody (M01), clone 3C6
| Brand: | Abnova |
| Reference: | H00002548-M01 |
| Product name: | GAA monoclonal antibody (M01), clone 3C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GAA. |
| Clone: | 3C6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2548 |
| Gene name: | GAA |
| Gene alias: | LYAG |
| Gene description: | glucosidase, alpha; acid |
| Genbank accession: | BC040431 |
| Immunogen: | GAA (AAH40431, 851 a.a. ~ 952 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC |
| Protein accession: | AAH40431 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GAA is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Discovery of a novel non-iminosugar acid alpha glucosidase chaperone series.Xiao J, Westbroek W, Motabar O, Lea WA, Hu X, Velayati A, Zheng W, Southall N, Gustafson AM, Goldin E, Sidransky E, Liu K, Simeonov A, Ribes A, Matalonga L, Ferrer M, Marugan JJ, Tamargo RJ. J Med Chem. 2012 Jul 26. |