Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of G6PD monoclonal antibody (M01A), clone 3H5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA |
More info about G6PD monoclonal antibody (M01A), clone 3H5
| Brand: | Abnova |
| Reference: | H00002539-M01A |
| Product name: | G6PD monoclonal antibody (M01A), clone 3H5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant G6PD. |
| Clone: | 3H5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2539 |
| Gene name: | G6PD |
| Gene alias: | G6PD1 |
| Gene description: | glucose-6-phosphate dehydrogenase |
| Genbank accession: | BC000337 |
| Immunogen: | G6PD (AAH00337, 406 a.a. ~ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGTYKWVNPHKL |
| Protein accession: | AAH00337 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | G6PD monoclonal antibody (M01A), clone 3H5. Western Blot analysis of G6PD expression in human kidney. |
| Applications: | WB-Ti,ELISA |
| Shipping condition: | Dry Ice |