Brand: | Abnova |
Reference: | H00002539-M01A |
Product name: | G6PD monoclonal antibody (M01A), clone 3H5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant G6PD. |
Clone: | 3H5 |
Isotype: | IgG2a Kappa |
Gene id: | 2539 |
Gene name: | G6PD |
Gene alias: | G6PD1 |
Gene description: | glucose-6-phosphate dehydrogenase |
Genbank accession: | BC000337 |
Immunogen: | G6PD (AAH00337, 406 a.a. ~ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGTYKWVNPHKL |
Protein accession: | AAH00337 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | G6PD monoclonal antibody (M01A), clone 3H5. Western Blot analysis of G6PD expression in human kidney. |
Applications: | WB-Ti,ELISA |
Shipping condition: | Dry Ice |