Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FZD2 monoclonal antibody (M01A), clone 2C8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about FZD2 monoclonal antibody (M01A), clone 2C8
| Brand: | Abnova |
| Reference: | H00002535-M01A |
| Product name: | FZD2 monoclonal antibody (M01A), clone 2C8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FZD2. |
| Clone: | 2C8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2535 |
| Gene name: | FZD2 |
| Gene alias: | - |
| Gene description: | frizzled homolog 2 (Drosophila) |
| Genbank accession: | NM_001466 |
| Immunogen: | FZD2 (NP_001457, 192 a.a. ~ 245 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR |
| Protein accession: | NP_001457 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.68 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |