FZD2 polyclonal antibody (A01) View larger

FZD2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FZD2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FZD2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00002535-A01
Product name: FZD2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant FZD2.
Gene id: 2535
Gene name: FZD2
Gene alias: -
Gene description: frizzled homolog 2 (Drosophila)
Genbank accession: NM_001466
Immunogen: FZD2 (NP_001457, 192 a.a. ~ 245 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR
Protein accession: NP_001457
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002535-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.05 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FZD2 polyclonal antibody (A01) now

Add to cart