FYN monoclonal antibody (M04), clone 2G2 View larger

FYN monoclonal antibody (M04), clone 2G2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FYN monoclonal antibody (M04), clone 2G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about FYN monoclonal antibody (M04), clone 2G2

Brand: Abnova
Reference: H00002534-M04
Product name: FYN monoclonal antibody (M04), clone 2G2
Product description: Mouse monoclonal antibody raised against a partial recombinant FYN.
Clone: 2G2
Isotype: IgG1 Kappa
Gene id: 2534
Gene name: FYN
Gene alias: MGC45350|SLK|SYN
Gene description: FYN oncogene related to SRC, FGR, YES
Genbank accession: BC032496
Immunogen: FYN (AAH32496, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVAL
Protein accession: AAH32496
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002534-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002534-M04-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged FYN is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FYN monoclonal antibody (M04), clone 2G2 now

Add to cart