FY MaxPab mouse polyclonal antibody (B01) View larger

FY MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FY MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FY MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00002532-B01
Product name: FY MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human FY protein.
Gene id: 2532
Gene name: DARC
Gene alias: CCBP1|CD234|Dfy|FY|GPD|GpFy|WBCQ1
Gene description: Duffy blood group, chemokine receptor
Genbank accession: BC017817
Immunogen: FY (AAH17817, 1 a.a. ~ 336 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLSMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWFSHLDTLGSKS
Protein accession: AAH17817
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002532-B01-13-15-1.jpg
Application image note: Western Blot analysis of DARC expression in transfected 293T cell line (H00002532-T01) by DARC MaxPab polyclonal antibody.

Lane 1: FY transfected lysate(37.07 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FY MaxPab mouse polyclonal antibody (B01) now

Add to cart