Brand: | Abnova |
Reference: | H00002531-M09 |
Product name: | FVT1 monoclonal antibody (M09), clone 3E8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant FVT1. |
Clone: | 3E8 |
Isotype: | IgG1 Kappa |
Gene id: | 2531 |
Gene name: | KDSR |
Gene alias: | DHSR|FLJ36555|FLJ92680|FVT1|SDR35C1 |
Gene description: | 3-ketodihydrosphingosine reductase |
Genbank accession: | BC008797 |
Immunogen: | FVT1 (AAH08797.1, 1 a.a. ~ 332 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTA |
Protein accession: | AAH08797.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (62.15 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |