FUT7 monoclonal antibody (M05), clone 1A12 View larger

FUT7 monoclonal antibody (M05), clone 1A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FUT7 monoclonal antibody (M05), clone 1A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about FUT7 monoclonal antibody (M05), clone 1A12

Brand: Abnova
Reference: H00002529-M05
Product name: FUT7 monoclonal antibody (M05), clone 1A12
Product description: Mouse monoclonal antibody raised against a partial recombinant FUT7.
Clone: 1A12
Isotype: IgG2a Kappa
Gene id: 2529
Gene name: FUT7
Gene alias: FucT-VII
Gene description: fucosyltransferase 7 (alpha (1,3) fucosyltransferase)
Genbank accession: NM_004479
Immunogen: FUT7 (NP_004470, 262 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
Protein accession: NP_004470
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002529-M05-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged FUT7 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy FUT7 monoclonal antibody (M05), clone 1A12 now

Add to cart