FUT5 monoclonal antibody (M03), clone 1H6 View larger

FUT5 monoclonal antibody (M03), clone 1H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FUT5 monoclonal antibody (M03), clone 1H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about FUT5 monoclonal antibody (M03), clone 1H6

Brand: Abnova
Reference: H00002527-M03
Product name: FUT5 monoclonal antibody (M03), clone 1H6
Product description: Mouse monoclonal antibody raised against a partial recombinant FUT5.
Clone: 1H6
Isotype: IgG2b Kappa
Gene id: 2527
Gene name: FUT5
Gene alias: FUC-TV
Gene description: fucosyltransferase 5 (alpha (1,3) fucosyltransferase)
Genbank accession: NM_002034
Immunogen: FUT5 (NP_002025, 95 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPSNCRHLEALDG
Protein accession: NP_002025
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002527-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002527-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged FUT5 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FUT5 monoclonal antibody (M03), clone 1H6 now

Add to cart