Brand: | Abnova |
Reference: | H00002524-M02 |
Product name: | FUT2 monoclonal antibody (M02), clone 4C12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FUT2. |
Clone: | 4C12 |
Isotype: | IgG2a Kappa |
Gene id: | 2524 |
Gene name: | FUT2 |
Gene alias: | SE|SEC2|Se2|sej |
Gene description: | fucosyltransferase 2 (secretor status included) |
Genbank accession: | NM_000511 |
Immunogen: | FUT2 (NP_000502, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHFPGEYVRFTGY |
Protein accession: | NP_000502 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | FUT2 monoclonal antibody (M02), clone 4C12 Western Blot analysis of FUT2 expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |