FRZB monoclonal antibody (M07), clone 3C3 View larger

FRZB monoclonal antibody (M07), clone 3C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FRZB monoclonal antibody (M07), clone 3C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about FRZB monoclonal antibody (M07), clone 3C3

Brand: Abnova
Reference: H00002487-M07
Product name: FRZB monoclonal antibody (M07), clone 3C3
Product description: Mouse monoclonal antibody raised against a full length recombinant FRZB.
Clone: 3C3
Isotype: IgG2a Kappa
Gene id: 2487
Gene name: FRZB
Gene alias: FRE|FRITZ|FRP-3|FRZB-1|FRZB-PEN|FRZB1|FZRB|SFRP3|SRFP3|hFIZ
Gene description: frizzled-related protein
Genbank accession: NM_001463
Immunogen: FRZB (NP_001454, 102 a.a. ~ 190 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY*
Protein accession: NP_001454
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002487-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002487-M07-13-15-1.jpg
Application image note: Western Blot analysis of FRZB expression in transfected 293T cell line by FRZB monoclonal antibody (M07), clone 3C3.

Lane 1: FRZB transfected lysate(36.3 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FRZB monoclonal antibody (M07), clone 3C3 now

Add to cart